1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. B7-2/CD86
  5. B7-2/CD86 Protein, Human (HEK293, Fc)

B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

Background

CD86 is a transmembrane region, and a longer cytoplasmic domain than CD80. CD86 is constitutively expressed on interdigitating dendritic cells (DCs), Langerhans cells, peripheral blood DCs, memory B cells and germinal center B cells, and macrophages. CD86 is rapidly upregulated on B cells following activation by cross-linking of the Ig receptor or the addition of a variety of cytokines[1].

Biological Activity

Immobilized B7-2/CD86-Fc at 5 μg/mL (100 μL/well) can bind human Biotin-CD28-Fc with a linear range of 0.09~3.12μg/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P42081 (L20-P247)

Gene ID

942  [NCBI]

Molecular Construction
N-term
B7-2 (L20-P247)
Accession # P42081
hFc
C-term
Synonyms
rHuB7-2/CD86, Fc Chimera; Activation B7-2 antigen; B70; BU63; CD86; CD28LG2
AA Sequence

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Molecular Weight

65-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, 5% trehalose and mannitol.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-2/CD86 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P7322
Quantity:
MCE Japan Authorized Agent: