Basigin/CD147 Protein, Mouse (304a.a, HEK293, His)

The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (304a.a, HEK293, His) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-6*His labeled tag.

Basigin/CD147 protein is indispensable for normal retinal maturation and development, acting as a crucial cell surface receptor for NXNL1 and contributing significantly to NXNL1-mediated survival of retinal cone photoreceptors. In collaboration with the glucose transporter SLC16A1/GLUT1 and NXNL1, Basigin/CD147 promotes retinal cone survival by enhancing aerobic glycolysis and facilitating the entry of glucose into photoreceptors. It serves as a signaling receptor for cyclophilins, playing an essential role in PPIA/CYPA and PPIB/CYPB-dependent signaling related to the chemotaxis and adhesion of immune cells. Additionally, Basigin/CD147 is pivotal in targeting the monocarboxylate transporters SLC16A1, SLC16A3, and SLC16A8 to the plasma membrane. Acting as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells, it enhances VEGFA-mediated activation and downstream signaling, promoting angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2. Moreover, Basigin/CD147 plays a crucial role in spermatogenesis, mediating interactions between germ cells and Sertoli cells and proving essential for the development and differentiation of germ cells into round spermatids.

Mouse

HEK293

C-6*His

P18572-1 (A22-R325)

12215  [NCBI]

AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR

45-65 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.