Biglycan Protein, Mouse (HEK293, Fc)

Biglycan proteins may be involved in collagen fiber assembly, suggesting a role in organizing and building collagen networks. Its involvement suggests a crucial function in extracellular matrix formation and maintenance. Biglycan Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Biglycan protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Biglycan Protein, Mouse (HEK293, Fc) is 332 a.a., with molecular weight of ~75-100 kDa.

Biglycan Protein emerges as a potential participant in collagen fiber assembly, suggesting a role in the intricate processes of organizing and structuring collagen networks. Its involvement in collagen fiber assembly implies a crucial function in the formation and maintenance of the extracellular matrix. As an essential component of connective tissues, Biglycan may contribute to the stability and integrity of collagen fibers. Elucidating the specific mechanisms through which Biglycan participates in collagen assembly could provide valuable insights into its role in tissue development, repair, and homeostasis. Further exploration of Biglycan's functions may deepen our understanding of its implications in connective tissue biology and its potential significance in various physiological contexts.

Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED₅₀ for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×10³units/mg.

• 
  Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED₅₀ for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×10³ units/mg.

Mouse

HEK293

C-hFc

P28653 (D38-K369)

12111  [NCBI]

DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Approximately 75-100 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.