BMP-15 Protein, Human (His, Myc, soluition)

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells. The total length of human BMP-15 protein is 392 amino acids (M1-R392), with 4 glycosylation domains. BMP-15 Protein, Human (His, Myc, soluition) is the protein in solution form, expressed in E. coli cells with a N-terminal His-tag and a C-terminal Myc-tag, respectively.

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth and differentiation factor 9B (GDF9B), is a polymorphic ligand protein belonging to the TGFβ family and expresses exclusively in the oocyte^[1].
BMP15 is closely related to GDF9, which is essential for early ovarian folliculogenesis^[1].
BMP15 and GDF9 involve in the genetic control of follicular development. Their main functions include regulating cellular proliferation/differentiation, follicular survival/atresia, and oocyte maturation, to creat an environment supporting follicle selection and growth^[2].
BMP15 involves in p38 MAPK pathway to up-regulate anti-Mullerian hormone (AMH) expression in granulosa cells, which is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles^[3].
Otherwise, BMP15 binds HIF-1α/SCF signaling pathway to induce stem cell factor (SCF) expression in human GCs of polycystic ovary syndrome (PCOS) related follicles^[4].
BMP-15 is widely found in different animals, while the sequence in human is different from rat (63.66%), and mouse (64.01).

BMP-15 (huamn; 500 ng/mL; 48 h) induces FSHR expression in HGrC1 cells^[5].
BMP-15 (huamn; 500 ng/mL; 0-90 min) increases phosphorylation of Smad 1/5/8 in HGrC1 cells^[5].

Human

E. coli

N-His;C-Myc

O95972 (Q268-R392)

9210  [NCBI]

QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Approximately 23.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Galloway SM, et al. Bmp15 mutations and ovarian function. Mol Cell Endocrinol. 2002 May 31;191(1):15-8.  [Content Brief]

  [2]. Liu MN, et al. The role of BMP15 and GDF9 in the pathogenesis of primary ovarian insufficiency. Hum Fertil (Camb). 2021 Dec;24(5):325-332.  [Content Brief]

  [3]. Zhao Z, et al. BMP15 regulates AMH expression via the p38 MAPK pathway in granulosa cells from goat. Theriogenology. 2018 Sep 15;118:72-79.  [Content Brief]

  [4]. Cao LY, et al. Aberrant BMP15/HIF-1α/SCF signaling pathway in human granulosa cells is involved in the PCOS related abnormal follicular development. Gynecol Endocrinol. 2022 Sep 23:1-7.  [Content Brief]

  [5]. Shimizu K, et al. Molecular mechanism of FSHR expression induced by BMP15 in human granulosa cells. J Assist Reprod Genet. 2019 Jun;36(6):1185-1194.  [Content Brief]