BPHL Protein, Human (His)

The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (His) is the recombinant human-derived BPHL protein, expressed by E. coli , with N-His labeled tag. The total length of BPHL Protein, Human (His) is 254 a.a., with molecular weight of ~30 KDa.

BPHL protein, a serine hydrolase, serves as a catalyst for the hydrolytic activation of amino acid ester prodrugs, exemplified by nucleoside analogs like valacyclovir and valganciclovir. Notably, it facilitates the conversion of valacyclovir to acyclovir through hydrolysis. Beyond its role in drug activation, BPHL is implicated in potential detoxification processes. As a specific alpha-amino acid ester hydrolase, it displays a preference for small, hydrophobic, and aromatic side chains, without imposing strict requirements on the leaving group, except for a preference toward a primary alcohol. Existing as a monomer, BPHL may also engage in the formation of homodimers.

Defined as the amount of valacyclovir that 1μg of BPHL can hydrolysis at 37°C for 1 minute. The specific activity is 25.264 pmol/min/μg.

Human

E. coli

N-6*His

Q86WA6-1 (S38-Q291)

670  [NCBI]

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Approximately 30 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.