BTNL6 Protein, Mouse (HEK293, His)

BTNL6 Protein, part of the immunoglobulin superfamily in the BTN/MOG family, is associated with immune responses and cellular recognition. Its membership suggests involvement in diverse immunological processes, potentially contributing to intricate immune regulation. Further exploration is needed to understand BTNL6's specific functions within the broader immunoglobulin superfamily context and its role in modulating immune responses. BTNL6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived BTNL6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BTNL6 Protein, Mouse (HEK293, His) is 221 a.a., with molecular weight of ~30 kDa.

BTNL6 protein is a member of the immunoglobulin superfamily and is classified within the BTN/MOG family. This affiliation indicates its association with molecules involved in immune responses and cellular recognition. As a member of the immunoglobulin superfamily, BTNL6 likely participates in diverse immunological processes, potentially engaging in intricate interactions that contribute to immune regulation. Further exploration is warranted to elucidate the specific functions and implications of BTNL6 within the broader context of the immunoglobulin superfamily and its role in modulating immune responses.

Mouse

HEK293

C-6*His

A2CG22 (K29-W249)

624681  [NCBI]

KEFQVFGPSDPIVAAPGGEAILPCSVIPAMNVENMEELRWFRSRFSAAVLVYRDQEEQKREQLPEYSQRTSLVKEQFHQGTAAVRILNVQAPDSGIYICHFKQGVFYEEAILELKVAAMGSVPEVYIKGPEDGGVCVVCITSGWYPEPQVHWKDSRGEKLTASLEIHSEDAQGLFRTETSLVVRDSSVRNVTCSTFNPILGQEKAMAMFLPEPFFPKVSPW

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine, 6% Trehalose, 4% Mannitol, 50 mM NaCl, 0.05% Tween 80, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.