1. Recombinant Proteins
  2. Others
  3. C1D Protein, Human (His)

C1D Protein, Human (His)

Cat. No.: HY-P74377
COA Handling Instructions

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-GST labeled tag. The total length of C1D Protein, Human (His) is 141 a.a., with molecular weight of ~18 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $215 In-stock
100 μg $350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-GST labeled tag. The total length of C1D Protein, Human (His) is 141 a.a., with molecular weight of ~18 kDa.

Background

C1D, a multifaceted protein, orchestrates various cellular processes with distinct functional implications. It plays a pivotal role in recruiting the RNA exosome complex to pre-rRNA, facilitating the intricate 3'-5' end processing of the 5.8S rRNA, possibly in collaboration with MPHOSPH6. Additionally, C1D exhibits a unique capability to activate PRKDC, not only in the presence of linear DNA but also in the presence of supercoiled DNA. Notably, it can induce apoptosis through a p53/TP53 dependent pathway, showcasing its regulatory role in programmed cell death. Furthermore, C1D may modulate the formation of the TRAX/TSN complex and enhances transcriptional repression by NR1D1 and THRB. As a molecular entity, C1D exists in monomeric and homodimeric forms, interacting with a spectrum of proteins including NR1D1, THRA, THRB, NCOR1, NCOR2, EXOSC10, TSNAX, and RAC3. This intricate network of interactions underscores the diverse functions and regulatory potential of C1D in cellular biology.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q13901 (M1-S141)

Gene ID
Molecular Construction
N-term
GST
C1D (M1-S141)
Accession # Q13901
C-term
Synonyms
Nuclear nucleic acid-binding protein C1D; hC1D; C1D
AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Molecular Weight

Approximately 18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

C1D Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C1D Protein, Human (His)
Cat. No.:
HY-P74377
Quantity:
MCE Japan Authorized Agent: