Calcium-sensing R/CaSR Protein, Human (HEK293, His)

Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing R/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing R/CaSR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Calcium-sensing R/CaSR Protein, Human (HEK293, His) is 582 a.a., with molecular weight of approximately 95-130 kDa.

The Calcium-sensing R/CaSR protein, a G-protein-coupled receptor, plays a pivotal role in detecting changes in extracellular calcium concentration, crucial for maintaining calcium homeostasis. This receptor senses fluctuations in circulating calcium levels and modulates the production of parathyroid hormone (PTH) in parathyroid glands. Its activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. The receptor's activation involves a co-agonist mechanism, where aromatic amino acids such as Trp or Phe, in concert with divalent cations like calcium or magnesium, achieve full activation. In the resting state, the receptor adopts an open conformation, with anion binding promoting the inactive configuration. Upon aromatic amino acid binding, the extracellular venus flytrap module groove closes, inducing a novel homodimer interface between subunits. Calcium ions further stabilize the active state by enhancing homodimer interactions between membrane-proximal domains. Notably, the receptor can be activated by AMG 416, a D-amino acid-containing peptide agonist under evaluation for treating secondary hyperparathyroidism in chronic kidney disease patients receiving hemodialysis, with AMG 416 acting through the formation of a disulfide bond with Cys-482.

Measured by its ability to inhibit the proliferation of HT-29 cells. The ED₅₀ for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.

• 
  Measured by its ability to inhibit the proliferation of HT-29 cells. The ED₅₀ for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.

Human

HEK293

C-6*His

P41180-1 (Y20-K601)

846  [NCBI]

YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK

approximately 95-130 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.