CALML3 Protein, Human (GST)

The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag. The total length of CALML3 Protein, Human (GST) is 149 a.a., with molecular weight of ~43.9 kDa.

The CALML3 protein appears to serve a dual role by functioning as a specific light chain for unconventional myosin-10 (MYO10) and enhancing MYO10 translation. Acting potentially as a chaperone, CALML3 aids in the synthesis of the emerging MYO10 heavy chain protein. Furthermore, CALML3 exhibits the capacity to compete with calmodulin for binding to cellular substrates, suggesting a regulatory role in calcium-dependent signaling pathways. Particularly, its interaction with MYO10 is calcium-dependent and proves essential for MYO10 function in the extension of filopodia—a crucial process for cellular morphology. The intricate interplay between CALML3 and MYO10 underscores its significance in regulating cytoskeletal dynamics and cellular functions, prompting further investigation into the precise molecular mechanisms underlying these interactions and their functional consequences.

Human

E. coli

N-GST

P27482 (M1-K149)

810  [NCBI]

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

Approximately 43.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.