1. Recombinant Proteins
  2. Others
  3. CALML3 Protein, Human (GST)

The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.

Background

The CALML3 protein appears to serve a dual role by functioning as a specific light chain for unconventional myosin-10 (MYO10) and enhancing MYO10 translation. Acting potentially as a chaperone, CALML3 aids in the synthesis of the emerging MYO10 heavy chain protein. Furthermore, CALML3 exhibits the capacity to compete with calmodulin for binding to cellular substrates, suggesting a regulatory role in calcium-dependent signaling pathways. Particularly, its interaction with MYO10 is calcium-dependent and proves essential for MYO10 function in the extension of filopodia—a crucial process for cellular morphology. The intricate interplay between CALML3 and MYO10 underscores its significance in regulating cytoskeletal dynamics and cellular functions, prompting further investigation into the precise molecular mechanisms underlying these interactions and their functional consequences.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P27482 (M1-K149)

Gene ID

810  [NCBI]

Molecular Construction
N-term
GST
CALML3 (M1-K149)
Accession # P27482
C-term
Synonyms
CALL3_HUMAN; CALML3; Calmodulin like 3; Calmodulin related protein NB 1; Calmodulin-like protein 3; Calmodulin-related protein NB-1; CaM like protein; CaM-like protein; CLP; OTTHUMP00000019004
AA Sequence

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

Molecular Weight

Approximately 43.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CALML3 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CALML3 Protein, Human (GST)
Cat. No.:
HY-P72110
Quantity:
MCE Japan Authorized Agent: