1. Recombinant Proteins
  2. Others
  3. Calreticulin/CALR Protein, Pig (P.pastoris, His)

Calreticulin/CALR Protein, Pig (P.pastoris, His)

Cat. No.: HY-P71722
Data Sheet Handling Instructions Technical Support

Calreticulin (CALR) is an essential calcium-binding chaperone involved in ER functions. It interacts with glycoproteins, facilitates NR3C1 nuclear export, regulates maternal gene expression, and aids in oocyte maturation. CALR is released during oocyte activation and prevents polyspermy. It forms an EIF2 complex with CELF1/CUGBP1, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5 and interacts with PDIA3/ERp57, SPACA9, TRIM21, PPIB, PDIA5, and CLCC1. Calreticulin/CALR Protein, Pig (P.pastoris, His) is the recombinant pig-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Calreticulin (CALR) is an essential calcium-binding chaperone involved in ER functions. It interacts with glycoproteins, facilitates NR3C1 nuclear export, regulates maternal gene expression, and aids in oocyte maturation. CALR is released during oocyte activation and prevents polyspermy. It forms an EIF2 complex with CELF1/CUGBP1, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5 and interacts with PDIA3/ERp57, SPACA9, TRIM21, PPIB, PDIA5, and CLCC1. Calreticulin/CALR Protein, Pig (P.pastoris, His) is the recombinant pig-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-His labeled tag.

Background

Calreticulin (CALR) is a calcium-binding chaperone that plays a crucial role in the endoplasmic reticulum (ER) by facilitating folding, oligomeric assembly, and quality control through the calreticulin/calnexin cycle. It interacts transiently with almost all monoglucosylated glycoproteins synthesized in the ER. Additionally, CALR interacts with the DNA-binding domain of NR3C1, promoting its nuclear export. CALR is also involved in regulating maternal gene expression and may contribute to oocyte maturation by maintaining calcium homeostasis. In non-activated oocytes, CALR is localized in cortical granules and is released during the cortical reaction upon oocyte activation, potentially preventing polyspermy. CALR exists as a monomer and is part of an EIF2 complex consisting of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5. It interacts with various proteins such as PDIA3/ERp57, SPACA9, TRIM21, NR3C1, PPIB, PDIA5, and CLCC1.

Species

Pig

Source

P. pastoris

Tag

N-His

Accession

P28491 (E18-L417)

Gene ID
Molecular Construction
N-term
His
CALR (E18-L417)
Accession # P28491
C-term
Synonyms
CALRCalreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
AA Sequence

EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL

Molecular Weight

Approximately 48.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Calreticulin/CALR Protein, Pig (P.pastoris, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calreticulin/CALR Protein, Pig (P.pastoris, His)
Cat. No.:
HY-P71722
Quantity:
MCE Japan Authorized Agent: