Calreticulin/CALR Protein, Pig (P.pastoris, His)

Calreticulin (CALR) is an essential calcium-binding chaperone involved in ER functions. It interacts with glycoproteins, facilitates NR3C1 nuclear export, regulates maternal gene expression, and aids in oocyte maturation. CALR is released during oocyte activation and prevents polyspermy. It forms an EIF2 complex with CELF1/CUGBP1, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5 and interacts with PDIA3/ERp57, SPACA9, TRIM21, PPIB, PDIA5, and CLCC1. Calreticulin/CALR Protein, Pig (P.pastoris, His) is the recombinant pig-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-His labeled tag.

Calreticulin (CALR) is a calcium-binding chaperone that plays a crucial role in the endoplasmic reticulum (ER) by facilitating folding, oligomeric assembly, and quality control through the calreticulin/calnexin cycle. It interacts transiently with almost all monoglucosylated glycoproteins synthesized in the ER. Additionally, CALR interacts with the DNA-binding domain of NR3C1, promoting its nuclear export. CALR is also involved in regulating maternal gene expression and may contribute to oocyte maturation by maintaining calcium homeostasis. In non-activated oocytes, CALR is localized in cortical granules and is released during the cortical reaction upon oocyte activation, potentially preventing polyspermy. CALR exists as a monomer and is part of an EIF2 complex consisting of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5. It interacts with various proteins such as PDIA3/ERp57, SPACA9, TRIM21, NR3C1, PPIB, PDIA5, and CLCC1.

Pig

P. pastoris

N-His

P28491 (E18-L417)

100381266  [NCBI]

EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL

Approximately 48.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.