1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Can f 4 Protein, Canine (HEK293, His)

Can f 4 Protein, Canine (HEK293, His), an IgE-binding dog dander protein, is an important respiratory allergen. Can f 4 Protein is a dog allergen of the lipocalin family. Can f 4 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 4 protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Can f 4 Protein, Canine (HEK293, His), an IgE-binding dog dander protein, is an important respiratory allergen. Can f 4 Protein is a dog allergen of the lipocalin family[1]. Can f 4 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 4 protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Background

Dog dander is a common cause of respiratory allergy, with symptoms including rhinitis, conjunctivitis and bronchial asthma. Extracts of dog hair and dander contain a complexity of allergenic and non-allergenic proteins. To date, the IgE reactivity of 4 dog allergens of the lipocalin protein family, Canf1, Canf2, Canf4, and Canf6, as well as the dog serum albumin Canf3 and the dog prostatic kallikrein Canf5, has been characterized in detail. The size and the amino acid composition of the ligand-binding pocket indicate that Canf4 is capable of binding only relatively small hydrophobic molecules which are different from those that Canf2 is able to bind. The crystal structure of Canf4 contained both monomeric and dimeric forms of the allergen, suggesting that Canf4 is able to form transient (weak) dimers. The dimeric structure of Canf4 is formed when the ends of four β-strands are packed against the same strands from the second monomer[1][2].

Species

Canine

Source

HEK293

Tag

C-His;C-6*His

Accession

NP_001177855.1 (Q17-E174)

Gene ID

100463491  [NCBI]

Molecular Construction
N-term
Canf4 (Q17-E174)
Accession # NP_001177855.1
His
C-term
Synonyms
Allergen Can f 4
AA Sequence

QLPLPNVLTQVSGPWKTLYISSNNLDKIGDNGPFRIYMRGINVDIPRLKMSFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNVDSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE

Molecular Weight

Approximately 19 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Can f 4 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Can f 4 Protein, Canine (HEK293, His)
Cat. No.:
HY-P77310
Quantity:
MCE Japan Authorized Agent: