2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Carbonic Anhydrase
  5. Carbonic Anhydrase 10
  6. Carbonic Anhydrase 10 Protein, Human (His)

Carbonic Anhydrase 10 Protein, Human (His)

Cat. No.: HY-P7725
Handling Instructions

Carbonic Anhydrase 10 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 10 is an inactive isoform of carbonic anhydrase (CAs).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 10 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 10 is an inactive isoform of carbonic anhydrase (CAs)[1].
Background

The catalytically inactive isoforms of carbonic anhydrase (CAs) are known as CA-related proteins (CARPs) VIII, X, and XI. They have highly conserved amino acid sequences. CARP X is more highly expressed in the pineal gland during night compared to the day time, suggesting a function for wake/sleep patterns[1].
Species

Human
Source

E. coli
Tag

C-6*His
Accession

Q9NS85-1 (A21-N300)
Gene ID
Molecular Construction
N-term
CA10 (A21-N300)
Accession # Q9NS85-1
6*His
C-term
Synonyms
rHuCarbonic Anhydrase 10, His; Carbonic Anhydrase-Related Protein 10; Carbonic Anhydrase-Related Protein X; CARP X; Cerebral Protein 15; CA10;
AA Sequence

AQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNHHHHHH

Molecular Weight

Approximately 31.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)
References

Carbonic Anhydrase 10 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 10 Protein, Human (His)
Cat. No.:
HY-P7725
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.