1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carbonic Anhydrase
  4. Carbonic Anhydrase 10
  5. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)

Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)

Cat. No.: HY-P72865
SDS COA Handling Instructions Technical Support

Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is 300 a.a., with molecular weight of ~38 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is 300 a.a., with molecular weight of ~38 kDa.

Background

Carbonic Anhydrase 10 (CA10) is a member of the alpha-carbonic anhydrase family and is characterized by the absence of catalytic activity. While it shares structural features with other carbonic anhydrases, CA10 diverges functionally by not participating in the catalysis of carbon dioxide and water to form bicarbonate and protons. The distinct properties of CA10 within the alpha-carbonic anhydrase family highlight its unique role, likely involving functions other than the canonical enzymatic activity associated with this protein family.

Biological Activity

Measured by its esterase activity. The specific activity is 130.5 pmol/min/μg, as measured with 1 mM 4-Nitrophenyl acetate and 1 μg enzyme at 400 nm in 100 μL of 12.5 mM Tris, 75 mM NaCl, pH 7.5.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P61215 (M1-N300)

Gene ID
Molecular Construction
N-term
Ca10 (M1-N300)
Accession # P61215
His
C-term
Synonyms
Carbonic anhydrase-related protein 10; CA-RP X; Cerebral protein 15; CA10
AA Sequence

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN

Molecular Weight

Approximately 38 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72865
Quantity:
MCE Japan Authorized Agent: