Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)

Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is 300 a.a., with molecular weight of ~38 kDa.

Carbonic Anhydrase 10 (CA10) is a member of the alpha-carbonic anhydrase family and is characterized by the absence of catalytic activity. While it shares structural features with other carbonic anhydrases, CA10 diverges functionally by not participating in the catalysis of carbon dioxide and water to form bicarbonate and protons. The distinct properties of CA10 within the alpha-carbonic anhydrase family highlight its unique role, likely involving functions other than the canonical enzymatic activity associated with this protein family.

Measured by its esterase activity. The specific activity is 130.5 pmol/min/μg, as measured with 1 mM 4-Nitrophenyl acetate and 1 μg enzyme at 400 nm in 100 μL of 12.5 mM Tris, 75 mM NaCl, pH 7.5.

Mouse

HEK293

C-His

P61215 (M1-N300)

72605  [NCBI]

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN

Approximately 38 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.