Carbonic Anhydrase 4 Protein, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 4 Protein, Human (HEK293, His) is 265 a.a., with molecular weight of ~30 kDa.

Carbonic Anhydrase 4 (CA4) serves a crucial role in cellular physiology by catalyzing the reversible hydration of carbon dioxide into bicarbonate and protons, a process essential for maintaining intracellular and extracellular pH balance. This enzymatic activity, documented across various studies, underscores its significance in pH homeostasis. CA4 may additionally play a role in stimulating the sodium/bicarbonate transporter activity of SLC4A4, contributing to pH regulation. Particularly noteworthy is its essential function in removing acid overload from the retina and retina epithelium, as well as facilitating acid release in the choriocapillaris within the choroid. The multifaceted role of CA4 highlights its indispensable contribution to maintaining cellular pH homeostasis and underscores its relevance in various physiological processes.

Measured by its esterase activity and the specific activity is >2 pmoles/min/μg.

Human

HEK293

C-His

P22748 (A19-K283)

762  [NCBI]

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.