1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 4 (CA IV)
  5. Carbonic Anhydrase 4 Protein, Human (HEK293, His)

Carbonic Anhydrase 4 Protein, Human (HEK293, His)

Cat. No.: HY-P72862
SDS COA Handling Instructions Technical Support

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 4 Protein, Human (HEK293, His) is 265 a.a., with molecular weight of ~30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
20 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 4 Protein, Human (HEK293, His) is 265 a.a., with molecular weight of ~30 kDa.

Background

Carbonic Anhydrase 4 (CA4) serves a crucial role in cellular physiology by catalyzing the reversible hydration of carbon dioxide into bicarbonate and protons, a process essential for maintaining intracellular and extracellular pH balance. This enzymatic activity, documented across various studies, underscores its significance in pH homeostasis. CA4 may additionally play a role in stimulating the sodium/bicarbonate transporter activity of SLC4A4, contributing to pH regulation. Particularly noteworthy is its essential function in removing acid overload from the retina and retina epithelium, as well as facilitating acid release in the choriocapillaris within the choroid. The multifaceted role of CA4 highlights its indispensable contribution to maintaining cellular pH homeostasis and underscores its relevance in various physiological processes.

Biological Activity

Measured by its esterase activity and the specific activity is >2 pmoles/min/μg.

Species

Human

Source

HEK293

Tag

C-His

Accession

P22748 (A19-K283)

Gene ID

762  [NCBI]

Molecular Construction
N-term
CA4 (A19-K283)
Accession # P22748
His
C-term
Synonyms
Carbonic anhydrase 4; Carbonate dehydratase IV; CA-IV; CA4
AA Sequence

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Weight

Approximately 30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Carbonic Anhydrase 4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 4 Protein, Human (HEK293, His)
Cat. No.:
HY-P72862
Quantity:
MCE Japan Authorized Agent: