Carbonic Anhydrase 8 Protein, Human (His)

Carbonic Anhydrase VIII/CA8 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 8 (CA8), an isozyme of α-carbonic anhydrases (CAs), is an allosteric inhibitor of inositol trisphosphate receptor-1 (ITPR1), which regulates neuronal intracellular calcium release^[1][2].

CA8 overexpression desensitizes neuronal cells to STS induced apoptotic stress and increases cell migration and invasion ability in neuronal cells. In addition, down-regulated CA8 decreases neuron mobility in neuronal cells and leads to abnormal calcium release in cerebellar granule neurons. Knockdown of the ca8 gene results in an abnormal movement pattern in zebrafish^[2].

Human

E. coli

C-6*His

P35219 (A2-Q290)

767  [NCBI]

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQHHHHHH

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Gerald Z Zhuang, et al. Human carbonic anhydrase-8 AAV8 gene therapy inhibits nerve growth factor signaling producing prolonged analgesia and anti-hyperalgesia in mice. Gene Ther. 2018 Jul;25(4):297-311.  [Content Brief]

  [2]. Min-Syuan Huang, et al. Roles of carbonic anhydrase 8 in neuronal cells and zebrafish. Biochim Biophys Acta. 2014 Sep;1840(9):2829-42.  [Content Brief]