1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Caspase
  4. Caspase-1
  5. Caspase-1/CASP1 p20 Protein, Human (GST)

Caspase-1/CASP1 is a thiol protease complex involved in inflammation by catalyzing the cleavage of IL1B, IL18, and Gasdermin-D (GSDMD). It activates a pro-inflammatory response, releases mature cytokines IL1B and IL18, and initiates pyroptosis through cleavage of GSDMD. Caspase-1/CASP1 Protein, Human (GST) is the recombinant human-derived Caspase-1/CASP1 protein, expressed by E. coli , with N-GST labeled tag. The total length of Caspase-1/CASP1 p20 Protein, Human (GST) is 150 a.a., with molecular weight of ~43.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Caspase-1/CASP1 is a thiol protease complex involved in inflammation by catalyzing the cleavage of IL1B, IL18, and Gasdermin-D (GSDMD). It activates a pro-inflammatory response, releases mature cytokines IL1B and IL18, and initiates pyroptosis through cleavage of GSDMD. Caspase-1/CASP1 Protein, Human (GST) is the recombinant human-derived Caspase-1/CASP1 protein, expressed by E. coli , with N-GST labeled tag. The total length of Caspase-1/CASP1 p20 Protein, Human (GST) is 150 a.a., with molecular weight of ~43.8 kDa.

Background

Caspase-1/CASP1 subunit p10 Protein, a thiol protease, intricately participates in various inflammatory processes by catalyzing the proteolytic cleavage of precursor proteins associated with inflammation. This includes interleukin-1 beta (IL1B) and interleukin 18 (IL18), pivotal inflammatory cytokines, as well as the pyroptosis inducer Gasdermin-D (GSDMD), converting them into active mature peptides. Functioning as a key initiator of cell immunity, Caspase-1 activates a pro-inflammatory response upon inflammasome complex formation, leading to the release of mature cytokines IL1B and IL18, which play critical roles in diverse inflammatory pathways. Caspase-1's activity extends to initiating pyroptosis, a programmed lytic cell death pathway, by cleaving GSDMD. Notably, unlike its cleavage of interleukins, the recognition and cleavage of GSDMD depend on an exosite interface on CASP1, emphasizing its versatile and complex regulatory roles. Moreover, Caspase-1 activates CASP7 in response to bacterial infection, promoting plasma membrane repair, and controls antiviral immunity by cleaving CGAS upon inflammasome activation during DNA virus infection. In apoptotic cells, Caspase-1 cleaves SPHK2, which remains enzymatically active extracellularly. Despite its involvement in diverse cellular processes, Caspase-1 is apoptosis inactive.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P29466 (N120-N269)

Gene ID

834  [NCBI]

Molecular Construction
N-term
GST
CASP1 p20 (N120-N269)
Accession # P29466
C-term
Synonyms
CASP-1; CASP1; CASP1_HUMAN; Caspase 1; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45
AA Sequence

NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN

Molecular Weight

Approximately 43.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Caspase-1/CASP1 p20 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Caspase-1/CASP1 p20 Protein, Human (GST)
Cat. No.:
HY-P72117
Quantity:
MCE Japan Authorized Agent: