1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. CSF & Receptors Macrophage CD Proteins Monocyte CD Proteins Endothelial cell CD Proteins
  4. CD131
  5. CD131 Protein, Rat (HEK293, Fc)

The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD131, a cell surface receptor, plays a pivotal role in immune response by controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Through the formation of a heterodimeric receptor with various partners such as IL3RA, IL5RA, or CSF2RA, CD131 engages in multiple signaling pathways, including interleukin-3, interleukin-5, and granulocyte-macrophage colony-stimulating factor/CSF2 pathways. In unstimulated conditions, CD131 constitutively interacts with JAK1, and ligand binding leads to JAK1 stimulation, triggering the activation of the JAK-STAT pathway. CD131 forms a heterodimer composed of an alpha and a beta subunit, with the beta subunit being common to the IL3, IL5, and GM-CSF receptors. The GM-CSF receptor complex, involved in signaling, is a dodecamer consisting of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. CD131 further interacts with TMEM102, FCER1G, LYN, and JAK1, contributing to its intricate role in cellular responses.

Biological Activity

Measured by its binding ability in a functional ELISA. Recombinant Human CD131 binds Recombinant Human GM-CSF in the presence of Recombinant Human GM-CSF R alpha (1 μg/mL). The ED50 for this effect is 65.39 ng/mL.

  • Measured by its binding ability in a functional ELISA. Recombinant Human CD131 binds Recombinant Human GM-CSF in the presence of Recombinant Human GM-CSF R alpha (1 μg/mL). The ED50 for this effect is 65.39 ng/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q78ZF5 (E29-W440)

Gene ID
Molecular Construction
N-term
CD131 (E29-W440)
Accession # Q78ZF5
hFc
C-term
Synonyms
Cytokine receptor common subunit beta; CD131; CSF2RB; IL3RB; IL5RB
AA Sequence

EETVPLKTLQCYNDYIERIICSWADTEDAQGLVNLTLYHWLDKKQPMSCELSEDLMWSECPSSHRCVPRRCVLPYTQFSVSKEDYYSLQPDRDLSIHLVVPLAQHVQPPPPKDISISPSGDHFLLKWSVPLGDAQVSLLSQKDIQFEVAYKQLQDSWEDASSLHTCNLWVTLEPKLFLPNSIYVARVRAQLAPGSSLSGRPSGWSPEVHWDSPTEDKARPQNLQCFFDGIQSLNCSWEVWTKVTDSVSFGLFYSSSPKAGEKKCSPVVKELQASRYTRYHCSLNVSDPAAHSQYTVSVKRLEQGKFIESFNHIQMNPPTLNLTKNRDSYSLHWETQKMSYPFIQHAFQVQYKKKLDRWEDSKTENLNHAHSMDLPQLEPGTSYCARVRVKTIPEYKGLWSEWSNECTWTTDW

Molecular Weight

Approximately 80-95 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD131 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76195
Quantity:
MCE Japan Authorized Agent: