CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi)

CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is 217 a.a., with molecular weight of 45-65 kDa.

CD150/SLAMF1, a self-ligand receptor belonging to the signaling lymphocytic activation molecule (SLAM) family, plays a pivotal role in modulating the activation and differentiation of various immune cells, thereby contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of CD150 are regulated by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150 induces distinct signal transduction events in T-lymphocytes compared to B-cells, involving two modes of signaling—one dependent on SH2D1A (and possibly SH2D1B) and another reliant on protein-tyrosine phosphatase 2C (PTPN11). CD150 mediates IL-2-independent proliferation of activated T-cells, induces IFN-gamma production, and participates in downstream signaling pathways involving INPP5D, DOK1, DOK2, PRKCQ, BCL10, and NFKB1. Furthermore, it plays crucial roles in the differentiation of T follicular helper cells, the regulation of allergic responses, and the modulation of innate immune responses against Gram-negative bacteria in macrophages. Additionally, CD150 acts as a receptor for Measles virus, including isoform 4.

Human

HEK293

C-Avi;C-6*His

Q13291-1 (A21-P237)

6504  [NCBI]

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

45-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.