CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi)

CD150/SLAMF1 Protein, a self-ligand receptor in the SLAM family, modulates immune cell activation and differentiation, influencing both innate and adaptive immune responses. Its activities depend on cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150 induces distinct signaling in T-lymphocytes and B-cells, involving SH2D1A (and possibly SH2D1B) and PTPN11. It drives IL-2-independent T-cell proliferation, IFN-gamma production, and downstream signaling pathways. CD150 is crucial for T follicular helper cell differentiation, allergic response regulation, and macrophage innate immune responses against Gram-negative bacteria. It also serves as a receptor for Measles virus, isoform 4 included. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293, with C-Avi, C-6*His labeled tag. The total length of CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is 217 a.a., with molecular weight of 45-65 kDa.

CD150/SLAMF1, a self-ligand receptor belonging to the signaling lymphocytic activation molecule (SLAM) family, plays a pivotal role in modulating the activation and differentiation of various immune cells, thereby contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of CD150 are regulated by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150 induces distinct signal transduction events in T-lymphocytes compared to B-cells, involving two modes of signaling—one dependent on SH2D1A (and possibly SH2D1B) and another reliant on protein-tyrosine phosphatase 2C (PTPN11). CD150 mediates IL-2-independent proliferation of activated T-cells, induces IFN-gamma production, and participates in downstream signaling pathways involving INPP5D, DOK1, DOK2, PRKCQ, BCL10, and NFKB1. Furthermore, it plays crucial roles in the differentiation of T follicular helper cells, the regulation of allergic responses, and the modulation of innate immune responses against Gram-negative bacteria in macrophages. Additionally, CD150 acts as a receptor for Measles virus, including isoform 4.

Human

HEK293

C-Avi;C-6*His

Q13291-1 (A21-P237)

6504  [NCBI]

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

45-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.