1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins
  4. CD150
  5. CD150/SLAMF1 Protein, Mouse (HEK293, His)

The CD150/SLAMF1 protein is an autoligand receptor in the SLAM family that complexly regulates the activation and differentiation of immune cells and is critical for innate and adaptive immune responses. CD150/SLAMF1 exhibits unique signaling in T lymphocytes and B cells through fine-tuning of cytoplasmic adapter proteins including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD150/SLAMF1 protein is an autoligand receptor in the SLAM family that complexly regulates the activation and differentiation of immune cells and is critical for innate and adaptive immune responses. CD150/SLAMF1 exhibits unique signaling in T lymphocytes and B cells through fine-tuning of cytoplasmic adapter proteins including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CD150/SLAMF1 protein functions as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, engaging in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of a diverse array of immune cells. This involvement positions CD150/SLAMF1 at the core of the regulatory network governing both innate and adaptive immune responses. The protein's activities are finely regulated by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 exhibits distinct signal-transduction events in T-lymphocytes compared to B-cells, with two discernible modes of signaling. One mode depends on SH2D1A (and perhaps SH2D1B), while the other operates through protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction. Initially proposed to associate with SH2D1A to prevent binding to inhibitory effectors, such as INPP5D/SHIP1 and PTPN11/SHP-2, signaling is also regulated by SH2D1A, which can interact with and recruit FYN, subsequently phosphorylating and activating CD150/SLAMF1. The protein plays crucial roles in immune responses, inducing IL-2-independent proliferation of activated T-cells and promoting IFN-gamma production. Downstream signaling involves INPP5D, DOK1, and DOK2, inhibiting IFN-gamma production in T-cells, and PRKCQ, BCL10, and NFKB1, enhancing T-cell activation and Th2 cytokine production. CD150/SLAMF1 also facilitates T-cell receptor-induced IL-4 secretion and inhibits antigen receptor-mediated IFN-gamma production in CD4(-)/CD8(-) T-cells. It is essential for IL-4 production by germinal center T follicular helper cells and may inhibit CD40-induced signal transduction in monocyte-derived dendritic cells. Additionally, CD150/SLAMF1, in conjunction with SLAMF6 and CD84/SLAMF5, may serve as a negative regulator of the humoral immune response. In the context of microbial infection, the protein participates in the innate immune response against Gram-negative bacteria in macrophages, likely recognizing bacterial surface components and regulating phagosome maturation, leading to increased NOX2 activity in the phagosomes.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9QUM4-1 (T25-P242)

Gene ID
Molecular Construction
N-term
CD150/SLAMF1 (T25-P242)
Accession # Q9QUM4-1
6*His
C-term
Synonyms
Signaling lymphocytic activation molecule; SLAM family member 1; CD150; SLAMF1; SLAM
AA Sequence

TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP

Molecular Weight

40-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD150/SLAMF1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72467
Quantity:
MCE Japan Authorized Agent: