PVR/CD155 Protein, Mouse (HEK293, His)

PVR/CD155 Protein, Mouse (HEK293, His) is a recombinant mouse CD155 expressed in HEK 293 cells with a His tag at the N-terminus. CD155 Protein plays a role in cancer cell invasion and migration^[1][2].

PVR/CD155, also known as the human poliovirus receptor (PVR) is a member of the subfamily of immunoglobulin (Ig)-like molecules composed of an N-terminal variable-like, followed by two constant-like extracellular domains, a single transmembrane region and a cytoplasmic tail of variable length. CD155 binds the extracellular matrix protein vitronectin thereby mediating cell to matrix contacts. The cytoplasmic tail of CD155 interacts with the μ1B subunit of the clathrin adaptor complex resulting in directed transport of CD155 in polarized epithelial cells^[1][2].

Mouse

HEK293

C-6*His

Q8K094 (D29-L348)

52118  [NCBI]

DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLHHHHHH

55-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mandai K, et, al. Nectins and nectin-like molecules in development and disease. Curr Top Dev Biol. 2015;112:197-231.  [Content Brief]

  [2]. Ravens I, et, al. Characterization and identification of Tage4 as the murine orthologue of human poliovirus receptor/CD155. Biochem Biophys Res Commun. 2003 Dec 26;312(4):1364-71.  [Content Brief]