1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. PVR/CD155
  6. PVR/CD155 Protein, Mouse (HEK293, His)

PVR/CD155 Protein, Mouse (HEK293, His) is a recombinant mouse CD155 expressed in HEK 293 cells with a His tag at the N-terminus. CD155 Protein plays a role in cancer cell invasion and migration.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PVR/CD155 Protein, Mouse (HEK293, His) is a recombinant mouse CD155 expressed in HEK 293 cells with a His tag at the N-terminus. CD155 Protein plays a role in cancer cell invasion and migration[1][2].

Background

PVR/CD155, also known as the human poliovirus receptor (PVR) is a member of the subfamily of immunoglobulin (Ig)-like molecules composed of an N-terminal variable-like, followed by two constant-like extracellular domains, a single transmembrane region and a cytoplasmic tail of variable length. CD155 binds the extracellular matrix protein vitronectin thereby mediating cell to matrix contacts. The cytoplasmic tail of CD155 interacts with the μ1B subunit of the clathrin adaptor complex resulting in directed transport of CD155 in polarized epithelial cells[1][2].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8K094 (D29-L348)

Gene ID
Molecular Construction
N-term
PVR (D29-L348)
Accession # Q8K094
6*His
C-term
Synonyms
rMuCD155, His; Poliovirus receptor; CD155 antigen; Nectin-like protein 5; Nectin-2; Tage4 receptor; PVR; CD155
AA Sequence

DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLHHHHHH

Molecular Weight

55-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PVR/CD155 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7789
Quantity:
MCE Japan Authorized Agent: