1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. MUC-24/CD164
  5. CD164 Protein, Rat (HEK293, Fc)

CD164 Protein, a sialomucin, crucially influences hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration and promoting the fusion of myoblasts into myotubes through interactions with CXCR4. This highlights CD164's significant role in various cellular activities related to muscle development and function. CD164 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD164 Protein, a sialomucin, crucially influences hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration and promoting the fusion of myoblasts into myotubes through interactions with CXCR4. This highlights CD164's significant role in various cellular activities related to muscle development and function. CD164 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD164 protein is a sialomucin that potentially plays a crucial role in hematopoiesis and may also be involved in cell adhesion. It exerts its influence on myogenesis by enhancing CXCR4-dependent cell motility and positively regulates the migration of myoblasts. Additionally, CD164 protein promotes the fusion of myoblasts into myotubes, a process that is analogous to other similar proteins. Notably, it interacts with CXCR4, further emphasizing its significance in various cellular activities related to muscle development and function.

Biological Activity

When Recombinant Rat CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 15.05 ng/mL.

  • When Recombinant Rat CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 15.05 ng/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q9QX82 (Q24-D160)

Gene ID
Molecular Construction
N-term
CD164 (Q24-D160)
Accession # Q9QX82
hFc
C-term
Synonyms
Sialomucin core protein 24; MUC-24; Endolyn; MGC-24; CD164
AA Sequence

QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTNNITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD

Molecular Weight

Approximately 90-120 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD164 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75618
Quantity:
MCE Japan Authorized Agent: