CD200R1L Protein, Human (HEK293, His)

The CD200R1L protein is a potential receptor for the CD200/OX2 cell surface glycoprotein and has been shown to play a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L may engage in complex interactions with CD200, contributing to immune regulation and cellular communication. CD200R1L Protein, Human (HEK293, His) is the recombinant human-derived CD200R1L protein, expressed by HEK293 , with C-His labeled tag.

CD200R1L Protein appears to function as a potential receptor for the CD200/OX2 cell surface glycoprotein. This designation suggests a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L likely participates in the intricate interactions between CD200 and its binding partner, contributing to the modulation of immune responses and cell communication. Exploring the specific mechanisms and downstream effects of CD200R1L's interaction with CD200/OX2 could deepen our understanding of its role in immune regulation and cellular processes, offering insights into its potential implications in health and disease.

Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED₅₀ for this effect is 1.605 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED₅₀ for this effect is 1.605 μg/mL.

Human

HEK293

C-6*His

Q6Q8B3-1 (G24-L239)

344807  [NCBI]

GKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCHVSHLTGNKSLSVKLNSGLRTSGSPALSLL

Approximately 40-56 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.