CD299 Protein, Human (HEK293, hFc)

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

CD299, a gene encoding a C-type lectin, plays crucial roles in cell adhesion and pathogen recognition. This receptor has broad specificity, recognizing a diverse array of pathogens with significant public health implications, including tuberculosis mycobacteria, Ebola, hepatitis C, HIV-1, influenza A, West Nile virus, and the SARS-CoV acute respiratory syndrome coronavirus. The protein structure comprises four distinct domains: a C-terminal carbohydrate recognition domain, a variable-length flexible tandem-repeat neck domain, a transmembrane region, and an N-terminal cytoplasmic domain involved in internalization. CD299 shares close sequence and functional similarities with its neighboring gene, CD209 (also known as DC-SIGN), though they differ in viral recognition and expression patterns. CD299 exhibits high expression in endothelial cells of the liver, lymph nodes, and placenta. Notably, polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. With biased expression observed in tissues such as the liver (RPKM 15.4) and lymph nodes (RPKM 9.8), CD299 emerges as a critical player in immune response and pathogen defense.

Measured by its binding ability in a functional ELISA. When Recombinant ICAM-3 Protein（HY-P72921）is immobilized at 2 µg/mL (100 µL/well), can bind Recombinant Human CD299 Protein. The ED₅₀ for this effect is 1.304 μg/mL.

Human

HEK293

N-hFc

Q9H2X3-1/NP_055072.3 (S78-E399)

10332

SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Approximately 65-77 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.