2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  5. CD300a
  6. CD300a/LMIR1 Protein, Mouse (HEK293, Fc)

CD300a/LMIR1 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P72514
Handling Instructions

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background

CD300a/LMIR1 protein serves as an inhibitory receptor that potentially contributes to the down-regulation of cytolytic activity in natural killer (NK) cells and the attenuation of mast cell degranulation. Additionally, it plays a negative regulatory role in Toll-like receptor (TLR) signaling, specifically mediated by MYD88 but not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 interacts with PTN6/SHP-1 and PTPN11/SHP-2, along with INPP5D.
Species

Mouse
Source

HEK293
Tag

C-hFc
Accession

Q6SJQ0-1 (L28-R183)
Gene ID
Molecular Construction
N-term
CD300A (L28-R183)
Accession # Q6SJQ0-1
hFc
C-term
Synonyms
CMRF35-like molecule 8; CLM-8; MAIR-1; CD300a
AA Sequence

LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR

Molecular Weight

58-75 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CD300a/LMIR1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300a/LMIR1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P72514
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.