1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. IREM-1/CD300f
  5. CD300LF Protein, Mouse (HEK293, Fc)

The CD300LF protein, also known as DEC-205/CD205, directs antigens to the antigen-processing compartment. It inhibits myeloid cells and mast cells and promotes phagocytosis of apoptotic cells. CD300LF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300LF protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD300LF protein, also known as DEC-205/CD205, directs antigens to the antigen-processing compartment. It inhibits myeloid cells and mast cells and promotes phagocytosis of apoptotic cells. CD300LF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300LF protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The CD300LF protein, also known as the DEC-205/CD205 protein, serves as an endocytic receptor responsible for directing captured antigens to a specialized antigen-processing compartment. It has been observed to function as an inhibitory receptor for myeloid cells and mast cells, positively regulating the phagocytosis of apoptotic cells through recognition and binding of phosphatidylserine (PS) ligands on the surface of apoptotic cells. CD300LF plays a crucial role in maintaining immune homeostasis by promoting macrophage-mediated efferocytosis while inhibiting dendritic cell-mediated efferocytosis. Additionally, it negatively regulates mast cell activation and allergic responses by binding to ceramide ligands. It may also act as a coreceptor for interleukin 4 (IL-4), enhancing IL-4 and IL-13-induced signaling. CD300LF negatively regulates Toll-like receptor signaling and inhibits osteoclast formation. Furthermore, it induces macrophage cell death upon engagement and acts as a functional receptor for murine norovirus (MNV), mediating viral entry and replication while determining MNV species tropism and rendering nonmurine mammalian cells susceptible to MNV infection.

Biological Activity

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED50 for this effect <11.3 μg/mL, corresponding to a specific activity is >88 U/mg.

Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

Q6SJQ7 (E20-S193)

Gene ID
Molecular Construction
N-term
CD300LF (E20-S193)
Accession # Q6SJQ7
mFc
C-term
Synonyms
CMRF35-like molecule 1; CLM-1; CD300 antigen-like family member F; CD300f
AA Sequence

EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPAIQVPITVPTMPPITSTTTIFTVTTTVKETSMFPTLTSYYSDNGHGGGDSGGGEDGVGDGFLDLS

Molecular Weight

Approximately 45.3 kDa.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300LF Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76793
Quantity:
MCE Japan Authorized Agent: