CD300LF Protein, Mouse (HEK293, Fc)

CD300LF protein, also known as DEC-205/CD205, directs antigens to an antigen-processing compartment. It inhibits myeloid and mast cells, promoting phagocytosis of apoptotic cells. It maintains immune homeostasis by enhancing macrophage-mediated efferocytosis and inhibiting dendritic cell-mediated efferocytosis. It binds to ceramide ligands, regulating mast cell activation and allergic responses. It enhances IL-4 and IL-13 signaling and inhibits Toll-like receptor signaling and osteoclast formation. It induces macrophage cell death, acts as a receptor for murine norovirus, and determines viral tropism. CD300LF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300LF protein, expressed by HEK293, with C-mFc labeled tag. The total length of CD300LF Protein, Mouse (HEK293, Fc) is 174 a.a., with molecular weight of ~45.3 KDa.

The CD300LF protein, also known as the DEC-205/CD205 protein, serves as an endocytic receptor responsible for directing captured antigens to a specialized antigen-processing compartment. It has been observed to function as an inhibitory receptor for myeloid cells and mast cells, positively regulating the phagocytosis of apoptotic cells through recognition and binding of phosphatidylserine (PS) ligands on the surface of apoptotic cells. CD300LF plays a crucial role in maintaining immune homeostasis by promoting macrophage-mediated efferocytosis while inhibiting dendritic cell-mediated efferocytosis. Additionally, it negatively regulates mast cell activation and allergic responses by binding to ceramide ligands. It may also act as a coreceptor for interleukin 4 (IL-4), enhancing IL-4 and IL-13-induced signaling. CD300LF negatively regulates Toll-like receptor signaling and inhibits osteoclast formation. Furthermore, it induces macrophage cell death upon engagement and acts as a functional receptor for murine norovirus (MNV), mediating viral entry and replication while determining MNV species tropism and rendering nonmurine mammalian cells susceptible to MNV infection.

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED₅₀ for this effect <11.3 μg/mL, corresponding to a specific activity is >88 U/mg.

Mouse

HEK293

C-mFc

Q6SJQ7 (E20-S193)

246746  [NCBI]

EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPAIQVPITVPTMPPITSTTTIFTVTTTVKETSMFPTLTSYYSDNGHGGGDSGGGEDGVGDGFLDLS

Approximately 45.3 kDa.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.