Fc gamma RIIA/CD32a Protein, Human (HEK293, His)

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167, , , , mutation.

The Fc gamma RIIA/CD32a protein assumes a pivotal role by specifically binding to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its interaction with IgG, Fc gamma RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, illustrating its crucial involvement in immune modulation. Notably, the protein promotes the phagocytosis of opsonized antigens, further contributing to immune defense mechanisms. Additionally, Fc gamma RIIA/CD32a engages in interactions with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, indicating its participation in intricate signaling pathways and the regulation of its cellular functions. These multifaceted interactions underscore the significance of Fc gamma RIIA/CD32a in orchestrating diverse immune responses.

1. Loaded Human CD32a His on HIS1K Biosensor, can bind Anti-Human HER2 mAb with an affinity constant of 0.98 uM as determined in BLI assay.
2. Immobilized  Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human IgG1  protein. The ED₅₀ for this effect is 3.612 μg/mL, corresponding to a specific  activity is 2.77×10² Unit/mg.

• 
  Immobilized Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 3.612 μg/mL, corresponding to a specific activity is 2.77×10² Unit/mg.

Human

HEK293

C-6*His

P12318-1 (A36-I218, H167)

2212  [NCBI]

AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI

25-34 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.