CD37 Protein, Mouse (HEK293, hFc)

The CD37 protein is known to interact with SCIMP, suggesting a functional link between the two molecules. CD37 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CD37 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CD37 Protein, Mouse (HEK293, hFc) is 130 a.a., with molecular weight of ~43.6 kDa.

CD37 protein is known to interact with SCIMP, indicating a functional association between these two molecules. CD37 is a transmembrane protein that belongs to the tetraspanin family and is primarily expressed on the surface of B cells and other immune cells. It plays a role in various cellular processes, including signal transduction, adhesion, and immune modulation. The interaction with SCIMP suggests a potential involvement of CD37 in immune signaling pathways or protein complex formation, but further investigation is necessary to fully elucidate the functional significance of this interaction.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD37 is used at 10 μg/mL can bind Recombinant Mouse CD19. The ED₅₀ for this effect is 4.604 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD37 is used at 10 μg/mL can bind Recombinant Mouse CD19. The ED₅₀ for this effect is 4.604 μg/mL.

Mouse

HEK293

N-hFc

Q61470 (R112-N241)

12493  [NCBI]

RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN

Approximately 50-60 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.