CD47 Protein, Mouse (HEK293, His)

The CD47 protein is an adhesive multifunctional protein that coordinates cell-cell interactions, serves as a THBS1 receptor, and regulates integrin signaling through heterotrimeric G proteins. It plays a key role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, immune regulation, and memory formation. CD47 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

CD47 Protein, an adhesive protein, orchestrates cell-to-cell interactions and acts as a receptor for thrombospondin THBS1, concurrently modulating integrin signaling through the activation of heterotrimeric G proteins. This multifaceted protein is intricately involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. CD47 plays a pivotal role in modulating pulmonary endothelin EDN1 signaling and acts as a pressor agent supporting blood pressure in response to THBS1-induced nitrous oxide (NO) signaling. Additionally, it contributes significantly to memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, CD47 prevents the maturation of immature dendritic cells, inhibits cytokine production by mature dendritic cells, and mediates cell-cell adhesion through interaction with SIRPG. Furthermore, it positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, potentially influencing metabolic dysregulation during normal aging. CD47's role in wound healing modulation, inhibition of stem cell self-renewal, potential involvement in membrane transport, integrin-dependent signal transduction, and prevention of premature elimination of red blood cells underscores its diverse impact on cellular processes. Existing as a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and possibly fibrinogen, emphasizing its intricate involvement in a wide array of cellular pathways.

Measured by its binding ability in a functional ELISA. Immobilized CD47 Protein, Mouse (HEK293, His) at 10μg/mL (100μL/well) can bind mouse SIRPA-Fc and the EC₅₀ is 0.07-0.3 μg/mL.

Mouse

HEK293

C-His

Q61735-1 (Q19-K140)

16423  [NCBI]

MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

34-44 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.