SLAMF2/CD48 Protein, Human (HEK293, His)

SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, His) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag. The total length of SLAMF2/CD48 Protein, Human (HEK293, His) is 194 a.a., with molecular weight of ~40 kDa.

The SLAMF2/CD48 Protein, a glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein, plays a pivotal role in immune cell regulation and activation by interacting through its N-terminal immunoglobulin domain with cell surface receptors, such as 2B4/CD244 or CD2. In T-cell signaling transduction, SLAMF2 associates with CD2, facilitating the efficient recruitment of the Src family protein kinase LCK and LAT to the TCR/CD3 complex, thereby promoting LCK phosphorylation and subsequent activation. Furthermore, SLAMF2 induces the phosphorylation of the cytoplasmic immunoreceptor tyrosine switch motifs (ITSMs) of CD244, initiating a cascade of signaling events that culminate in the formation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells. Notably, SLAMF2 interacts directly with CD2, CD244, and LCK, highlighting its intricate involvement in immune cell function and signaling pathways.

Human

HEK293

C-His

P09326 (Q27-S220)

962  [NCBI]

MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Approximately 40 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.