CD58 Protein, Human (HEK293, His)

CD58, a glycoprotein, is also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells^[1]. CD58 Protein, Human (HEK293, His) is the recombinant human-derived CD58 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD58 Protein, Human (HEK293, His) is 187 a.a., with molecular weight of 30-60 kDa.

CD58, a glycoprotein, also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and is distributed on various human tissue cells, such as T lymphocytes, NK cells, thymocytes, and a subset of bone marrow cells. CD58 can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells^[1].
CD58 has two isoforms: a type-I transmembrane form and a glycosylphosphatidylinositol (GPI)-anchored form. The GPI-anchored CD58 form is more effective in enhancing adhesion, but the transmembrane form is more critical for signal transduction. Furthermore, a soluble form of CD58 (sCD58) also exist in cellular supernatant in vitro and in local tissues in vivo. sCD58 is an immunosuppressive factor, and is involved in T/NK cell-mediated immune responses by affecting CD2-CD58 interaction. Altered accumulation of sCD58 may lead to immunosuppression of T/NK cells in the tumor microenvironment. Therefore, sCD58 as a novel immunotherapeutic target.^[1].

Measured in a cell proliferation assay using PHA-stimulated THP-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.4424 μg/mL,corresponding to a specific activity is 2.26×10³ units/mg.

• 
  Measured in a cell proliferation assay using PHA-stimulated THP‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.4424 μg/mL, corresponding to a specific activity is 2.26×10³ units/mg.

Human

HEK293

C-6*His

AAH05930 (F29-R215)

965  [NCBI]

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

30-60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.