1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Endothelial cell CD Proteins
  4. LAMP3/CD63
  5. CD63 Protein, Mouse (GST)

CD63 Protein, Mouse (GST)

Cat. No.: HY-P72124
SDS COA Handling Instructions

The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag. The total length of CD63 Protein, Mouse (GST) is 101 a.a., with molecular weight of ~38.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag. The total length of CD63 Protein, Mouse (GST) is 101 a.a., with molecular weight of ~38.5 kDa.

Background

The CD63 Protein functions as a cell surface receptor for TIMP1 and plays a crucial role in activating diverse cellular signaling cascades. It is involved in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Through its participation in these signaling pathways, CD63 promotes cell survival, orchestrates the reorganization of the actin cytoskeleton, facilitates cell adhesion, spreading, and migration. Additionally, it contributes to VEGFA signaling by regulating the internalization of KDR/VEGFR2. CD63 is indispensable for intracellular vesicular transport processes and is vital for the normal trafficking of the PMEL luminal domain, essential for the development and maturation of melanocytes. Furthermore, CD63 plays a role in the adhesion of leukocytes onto endothelial cells by regulating SELP trafficking. While it may be involved in mast cell degranulation in response to Ms4a2/FceRI stimulation, it does not participate in mast cell degranulation in response to other stimuli. CD63 engages in interactions with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, being essential for recruiting KDR to ITGB1 complexes, underlining its intricate involvement in various cellular processes. Additionally, CD63 interacts with SYT7.

Species

Mouse

Source

E. coli

Tag

N-GST

Accession

P41731 (A103-I203)

Gene ID
Molecular Construction
N-term
GST
CD63 (A103-I203)
Accession # P41731
C-term
Synonyms
Cd63CD63 antigen; CD antigen CD63
AA Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Molecular Weight

Approximately 38.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD63 Protein, Mouse (GST)
Cat. No.:
HY-P72124
Quantity:
MCE Japan Authorized Agent: