1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD8a
  5. CD8 alpha Protein, Rat (HEK293, Fc)

CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD8 alpha protein, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions in responses against both external and internal threats. In T-cells, it functions primarily as a coreceptor for the MHC class I molecule:peptide complex, interacting simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs). This interaction facilitates the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK, in turn, initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately leading to lymphokine production, motility, adhesion, and the activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism, allowing the conjugation and lysis of multiple target cells. CD8A homodimer molecules also contribute to the survival and differentiation of activated lymphocytes into memory CD8 T-cells. CD8 alpha forms disulfide-linked heterodimers with CD8B at the cell surface and also homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Additionally, it interacts with the MHC class I HLA-A/B2M dimer and associates with LCK in a zinc-dependent manner.

Biological Activity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 2.584 μg/mL, corresponding to a specific activity is 387.0 units/mg.

  • Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 2.584 μg/mL, corresponding to a specific activity is 387.0 units/mg.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P07725 (Q27-Y189)

Gene ID
Molecular Construction
N-term
CD8 alpha (M1-Y189)
Accession # P07725
hFc
C-term
Synonyms
T-cell surface glycoprotein CD8 alpha chain; CD8a; CD8A; MAL
AA Sequence

QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY

Molecular Weight

Approximately 50-56 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD8 alpha Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74267
Quantity:
MCE Japan Authorized Agent: