CD8 alpha Protein, Rat (HEK293, Fc)

CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs.It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways.CD8 alpha Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD8 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

The CD8 alpha protein, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions in responses against both external and internal threats. In T-cells, it functions primarily as a coreceptor for the MHC class I molecule:peptide complex, interacting simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs). This interaction facilitates the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK, in turn, initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately leading to lymphokine production, motility, adhesion, and the activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism, allowing the conjugation and lysis of multiple target cells. CD8A homodimer molecules also contribute to the survival and differentiation of activated lymphocytes into memory CD8 T-cells. CD8 alpha forms disulfide-linked heterodimers with CD8B at the cell surface and also homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Additionally, it interacts with the MHC class I HLA-A/B2M dimer and associates with LCK in a zinc-dependent manner.

Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 2.584 μg/mL, corresponding to a specific activity is 387.0 units/mg.

• 
  Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 2.584 μg/mL, corresponding to a specific activity is 387.0 units/mg.

Rat

HEK293

C-hFc

P07725 (Q27-Y189)

24930  [NCBI]

QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY

Approximately 50-56 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.