1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. DRAP-27/CD9
  5. CD9 Protein, Human (HEK293, His)

CD9 Protein, Human (HEK293, His)

Cat. No.: HY-P72701
SDS COA Handling Instructions

CD9 protein is an integral membrane protein that plays a critical regulatory role in processes such as sperm-egg fusion, platelet activation, and cell adhesion. CD9 is critical for sperm-egg fusion, coordinating multi-protein complexes on the oocyte surface. CD9 Protein, Human (HEK293, His) is the recombinant human-derived CD9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD9 Protein, Human (HEK293, His) is 84 a.a., with molecular weight of ~10 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CD9 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD9 protein is an integral membrane protein that plays a critical regulatory role in processes such as sperm-egg fusion, platelet activation, and cell adhesion. CD9 is critical for sperm-egg fusion, coordinating multi-protein complexes on the oocyte surface. CD9 Protein, Human (HEK293, His) is the recombinant human-derived CD9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD9 Protein, Human (HEK293, His) is 84 a.a., with molecular weight of ~10 kDa.

Background

CD9, an integral membrane protein, plays a pivotal role in regulating various biological processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Located at the cell surface of oocytes, CD9 is essential for sperm-egg fusion, potentially by orchestrating multiprotein complexes and membrane morphology required for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. Within macrophages, CD9 forms associations with CD81 and beta-1/beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. CD9 also hinders the fusion of mononuclear cell progenitors into osteoclasts responsible for bone resorption. Beyond its role in fusion events, CD9 acts as a receptor for PSG17 and is implicated in platelet activation, aggregation, paranodal junction formation, cell adhesion, cell motility, and tumor metastasis. CD9 forms disulfide-linked homodimers and higher homooligomers, as well as heterooligomers with other tetraspanin family members. It interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB1, and is part of integrin-tetraspanin complexes in the membrane of monocytes/macrophages. CD9 forms complexes with CD63, PTGFRN, IGSF8, CR2/CD21, and PDPN, playing a crucial role in diverse cellular functions and interactions in various contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P21926 (S112-I195)

Gene ID

928  [NCBI]

Molecular Construction
N-term
CD9 (S112-I195)
Accession # P21926
6*His
C-term
Synonyms
CD9 antigen; MIC3; TSPAN29; DRAP-27; MRP1; BTCC1; CD9
AA Sequence

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Molecular Weight

Approximately 10 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD9 Protein, Human (HEK293, His)
Cat. No.:
HY-P72701
Quantity:
MCE Japan Authorized Agent: