CELA2A Protein, Mouse (His)

CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag. The total length of CELA2A Protein, Mouse (His) is 241 a.a., with molecular weight of ~29.7 kDa.

The protein is involved in the regulation of innate immunity and the inflammatory response in response to IFN-gamma. It organizes the autophagic machinery by serving as a platform for the assembly of various proteins involved in autophagy. It also recognizes specific autophagy targets and coordinates target recognition with the initiation of autophagy.

Mouse

E. coli

N-6*His

P05208 (V31-N271)

13706  [NCBI]

VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Approximately 29.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.