1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemerin/RARRES2 Protein, Human (HEK293, His)

Chemerin/RARRES2 protein is an adipokine secreted by adipocytes that is activated by CMKLR1 and serves as a CMKLR2 ligand to complexly regulate adipogenesis, metabolism, and inflammation. It actively regulates adipocyte differentiation, affects lipid and glucose metabolism, and plays a role in angiogenesis. Chemerin/RARRES2 Protein, Human (HEK293, His) is the recombinant human-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Chemerin/RARRES2 Protein, Human (HEK293, His) is 137 a.a., with molecular weight of 16-20 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Chemerin/RARRES2 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Chemerin/RARRES2 protein is an adipokine secreted by adipocytes that is activated by CMKLR1 and serves as a CMKLR2 ligand to complexly regulate adipogenesis, metabolism, and inflammation. It actively regulates adipocyte differentiation, affects lipid and glucose metabolism, and plays a role in angiogenesis. Chemerin/RARRES2 Protein, Human (HEK293, His) is the recombinant human-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Chemerin/RARRES2 Protein, Human (HEK293, His) is 137 a.a., with molecular weight of 16-20 kDa.

Background

Chemerin/RARRES2 protein, an adipocyte-secreted adipokine, intricately regulates adipogenesis, metabolism, and inflammation by activating the chemokine-like receptor 1 (CMKLR1) and also functioning as a ligand for CMKLR2. While it can bind to C-C chemokine receptor-like 2 (CCRL2) with lower affinity than CMKLR1 or CMKLR2, its primary role involves positive regulation of adipocyte differentiation and modulation of adipocyte gene expression related to lipid and glucose metabolism. Additionally, Chemerin/RARRES2 plays a potential role in angiogenesis, a critical process for white adipose tissue expansion. Acting as a pro-inflammatory adipokine, it stimulates the secretion of pro-inflammatory and prodiabetic adipokines, adversely impacting adipose tissue metabolic function and leading to systemic effects such as impaired insulin sensitivity, altered glucose and lipid metabolism, and compromised vascular function in other tissues. The protein exhibits both pro- and anti-inflammatory properties based on enzymatic cleavage by different proteases, functioning as a chemotactic factor for leukocyte populations expressing CMKLR1 and exerting an anti-inflammatory role by inhibiting TNF/TNFA-induced VCAM1 expression in vascular endothelial cells. This dual role suggests a potential link between chronic inflammation, obesity, and associated disorders like type 2 diabetes and cardiovascular disease, while also exhibiting an antimicrobial function in the skin.

Biological Activity

1. Measured in a cell proliferation assay using HUVEC human ureteral epithelial cell. The ED50 for this effect is 7.695 ng/mL, corresponding to a specific activity is 1.3×105 units/mg.
2. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human ChemR23. The ED50 for this effect is 12.63 ng/mL, corresponding to a specific activity is 7.918×104 U/mg.

  • Measured in a cell proliferation assay using HUVEC human ureteral epithelial cell. The ED50 for this effect is 7.695 ng/ml, corresponding to a specific activity is 1.3×105 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q99969 (E21-S157)

Gene ID
Molecular Construction
N-term
Chemerin (E21-S157)
Accession # Q99969
6*His
C-term
Synonyms
rHuRetinoic acid receptor responder protein 2/Chemerin, His; Retinoic acid receptor responder protein 2; Chemerin; RAR-responsive protein TIG2; Tazarotene-induced gene 2 protein; RARRES2; TIG2
AA Sequence

ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Molecular Weight

16-20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Chemerin/RARRES2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Chemerin/RARRES2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70099
Quantity:
MCE Japan Authorized Agent: