1. Recombinant Proteins
  2. Receptor Proteins
  3. CHRNA1 Protein, Tetronarce californica (His-SUMO)

CHRNA1 Protein, Tetronarce californica (His-SUMO)

Cat. No.: HY-P72143
SDS COA Handling Instructions

The CHRNA1 Protein, recognized as the acetylcholine receptor (AChR), undergoes a crucial conformational shift upon acetylcholine binding. This alteration affects all subunits, activating an ion-conducting channel across the plasma membrane. The pentameric structure includes two alpha chains, in addition to one each of the beta, delta, and gamma chains. CHRNA1 Protein, Tetronarce californica (His-SUMO) is the recombinant CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CHRNA1 Protein, Tetronarce californica (His-SUMO) is 210 a.a., with molecular weight of ~40.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

CHRNA1 Protein, Tetronarce californica (His-SUMO) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CHRNA1 Protein, recognized as the acetylcholine receptor (AChR), undergoes a crucial conformational shift upon acetylcholine binding. This alteration affects all subunits, activating an ion-conducting channel across the plasma membrane. The pentameric structure includes two alpha chains, in addition to one each of the beta, delta, and gamma chains. CHRNA1 Protein, Tetronarce californica (His-SUMO) is the recombinant CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CHRNA1 Protein, Tetronarce californica (His-SUMO) is 210 a.a., with molecular weight of ~40.8 kDa.

Background

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes a significant conformational change upon binding to acetylcholine, impacting all subunits and resulting in the activation of an ion-conducting channel across the plasma membrane. It is comprised of a pentamer, consisting of two alpha chains, along with one each of the beta, delta, and gamma chains.

Species

Others

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P02710 (S25-I234)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
CHRNA1 (S25-I234)
Accession # P02710
C-term
Synonyms
CHRNA1Acetylcholine receptor subunit alpha
AA Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Molecular Weight

Approximately 40.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS,6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

CHRNA1 Protein, Tetronarce californica (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHRNA1 Protein, Tetronarce californica (His-SUMO)
Cat. No.:
HY-P72143
Quantity:
MCE Japan Authorized Agent: