CHRNB3 Protein, Human (HEK293, His)

CHRNB3 Protein, a vital constituent of the acetylcholine receptor (AChR), induces a significant conformational shift upon acetylcholine binding. This change affects all subunits, leading to the activation of an ion-conducting channel across the plasma membrane. The neuronal AChR complex comprises alpha and beta subunits, emphasizing their intricate collaboration in responding to acetylcholine stimulation. CHRNB3 Protein, Human (HEK293, His) is the recombinant human-derived CHRNB3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CHRNB3 Protein, Human (HEK293, His) is 208 a.a., with molecular weight of 30-40 kDa.

After binding acetylcholine, CHRNB3, an essential component of the acetylcholine receptor (AChR), triggers a profound conformational change that influences all subunits, ultimately resulting in the opening of an ion-conducting channel across the plasma membrane. The neuronal AChR complex is thought to consist of two distinct types of subunits, namely alpha and beta, highlighting the intricate interplay between these subunits in mediating the cellular response to acetylcholine stimulation.

Human

HEK293

C-6*His

Q05901 (I25-L232)

1142  [NCBI]

IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRL

30-40 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.