1. Recombinant Proteins
  2. Others
  3. CHST5 Protein, Mouse (HEK293, Fc)

CHST5 protein, utilizing PAPS, catalyzes sulfate transfer to position 6 of non-reducing GlcNAc residues in keratan, particularly in the cornea. This sulfonation is crucial for mediating keratan sulfate sulfation, a key process in maintaining corneal transparency. CHST5 acts on short and long carbohydrate substrates, emphasizing its role in corneal function and contribution to maintaining corneal transparency through keratan sulfate sulfation. CHST5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CHST5 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CHST5 Protein, Mouse (HEK293, Fc) is 369 a.a., with molecular weight of 75-80 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CHST5 protein, utilizing PAPS, catalyzes sulfate transfer to position 6 of non-reducing GlcNAc residues in keratan, particularly in the cornea. This sulfonation is crucial for mediating keratan sulfate sulfation, a key process in maintaining corneal transparency. CHST5 acts on short and long carbohydrate substrates, emphasizing its role in corneal function and contribution to maintaining corneal transparency through keratan sulfate sulfation. CHST5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CHST5 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CHST5 Protein, Mouse (HEK293, Fc) is 369 a.a., with molecular weight of 75-80 KDa.

Background

CHST5 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan, particularly in the cornea. This sulfonation process is crucial for mediating the sulfation of keratan, a key component that contributes to maintaining corneal transparency. CHST5 acts on both short and long carbohydrate substrates with poly-N-acetyllactosamine structures, targeting the non-reducing terminal GlcNAc. Additionally, this sulfotransferase may exhibit activity toward O-linked sugars of mucin-type acceptors. The specific enzymatic actions of CHST5 underscore its importance in the intricate processes involved in corneal function, emphasizing its role in the sulfation of keratan sulfate and its contribution to the maintenance of corneal transparency.

Biological Activity

Measured by its ability to transfer sulfate from PAPS to N-acetyl-D-glucosamine. The specific activity is 2765.67 pmol/min/μg that incubate at 37 ºC for 20 minutes.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q9QUP4 (S27-S395)

Gene ID
Molecular Construction
N-term
hFc
CHST5 (S27-S395)
Accession # Q9QUP4
C-term
Synonyms
Carbohydrate sulfotransferase 5; GST4; I-GlcNAc6ST; Gn6st-3
AA Sequence

SRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAPALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPLTVIRELYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHTLPFAKIRRVQELCGGALQLLGYRSVHSELEQRDLSLDLLLPRGMDSFKWASSTEKQPES

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CHST5 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHST5 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76823
Quantity:
MCE Japan Authorized Agent: