CHST5 Protein, Mouse (HEK293, Fc)

CHST5 protein, utilizing PAPS, catalyzes sulfate transfer to position 6 of non-reducing GlcNAc residues in keratan, particularly in the cornea. This sulfonation is crucial for mediating keratan sulfate sulfation, a key process in maintaining corneal transparency. CHST5 acts on short and long carbohydrate substrates, emphasizing its role in corneal function and contribution to maintaining corneal transparency through keratan sulfate sulfation. CHST5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CHST5 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CHST5 Protein, Mouse (HEK293, Fc) is 369 a.a., with molecular weight of 75-80 KDa.

CHST5 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan, particularly in the cornea. This sulfonation process is crucial for mediating the sulfation of keratan, a key component that contributes to maintaining corneal transparency. CHST5 acts on both short and long carbohydrate substrates with poly-N-acetyllactosamine structures, targeting the non-reducing terminal GlcNAc. Additionally, this sulfotransferase may exhibit activity toward O-linked sugars of mucin-type acceptors. The specific enzymatic actions of CHST5 underscore its importance in the intricate processes involved in corneal function, emphasizing its role in the sulfation of keratan sulfate and its contribution to the maintenance of corneal transparency.

Measured by its ability to transfer sulfate from PAPS to N-acetyl-D-glucosamine. The specific activity is 2765.67 pmol/min/μg that incubate at 37 ºC for 20 minutes.

Mouse

HEK293

N-hFc

Q9QUP4 (S27-S395)

56773  [NCBI]

SRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAPALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPLTVIRELYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHTLPFAKIRRVQELCGGALQLLGYRSVHSELEQRDLSLDLLLPRGMDSFKWASSTEKQPES

Approximately 75-80 kDa due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.