CIB2 Protein, Human (N-His)

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (N-His) is the recombinant human-derived CIB2, expressed by E. coli , with N-6*His labeled tag. The total length of CIB2 Protein, Human (N-His) is 187 a.a.,

CIB2 protein, a calcium- and integrin-binding protein, plays a crucial role in intracellular calcium homeostasis and functions as an auxiliary subunit of the sensory mechanoelectrical transduction (MET) channel in hair cells. Its essentiality for mechanoelectrical transduction currents in auditory hair cells underscores its significance in hearing. CIB2 regulates the function of hair cell mechanotransduction by influencing the distribution of transmembrane channel-like proteins TMC1 and TMC2 and by modulating the activity of MET channels in hair cells. Moreover, it is indispensable for maintaining the morphology and function of auditory hair cell stereocilia bundles and ensuring the survival of hair cells in the cochlea. Additionally, CIB2 plays a critical role in the maintenance and function of photoreceptor cells. Its involvement in intracellular calcium homeostasis is manifested through its ability to decrease ATP-induced calcium release. CIB2 exists as a monomer or homodimer and interacts with various proteins, including WHRN, MYO7A, ITGA2B, ITGA7, TMC1, and TMC2, with these interactions often being calcium and magnesium-dependent.

Human

E. coli

N-6*His

O75838-1 (M1-I187)

10518

MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Approximately 25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, pH 8.0, 20% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.