Citrate Synthase/CS Protein, Human (sf9, His)

Citrate Synthase (CS) is a key enzyme in carbohydrate metabolism, specifically in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA to form citrate. This enzymatic process represents the first and crucial step in the TCA cycle, which is fundamental to cellular energy production. By initiating the cycle and facilitating the condensation of acetyl-CoA with oxaloacetate, CS plays a central role in channeling metabolic intermediates towards the production of energy-rich molecules. This step not only generates citrate but also sets the stage for subsequent reactions in the TCA cycle, ultimately contributing to the efficient extraction of energy from carbohydrates and other metabolic substrates. The activity of CS is pivotal in maintaining cellular energy homeostasis and ensuring the proper functioning of aerobic metabolism. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of Citrate Synthase/CS Protein, Human (sf9, His) is 439 a.a., with molecular weight of ~46 kDa.

Citrate Synthase (CS) is a key enzyme in carbohydrate metabolism, specifically in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA to form citrate. This enzymatic process represents the first and crucial step in the TCA cycle, which is fundamental to cellular energy production. By initiating the cycle and facilitating the condensation of acetyl-CoA with oxaloacetate, CS plays a central role in channeling metabolic intermediates towards the production of energy-rich molecules. This step not only generates citrate but also sets the stage for subsequent reactions in the TCA cycle, ultimately contributing to the efficient extraction of energy from carbohydrates and other metabolic substrates. The activity of CS is pivotal in maintaining cellular energy homeostasis and ensuring the proper functioning of aerobic metabolism.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

C-His

O75390 (A28-G466)

1431  [NCBI]

ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

Approximately 46 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 7.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.