1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Citrate Synthase/CS Protein, Human (sf9, His)

Citrate Synthase (CS) is a key enzyme in carbohydrate metabolism, specifically in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA to form citrate. This enzymatic process represents the first and crucial step in the TCA cycle, which is fundamental to cellular energy production. By initiating the cycle and facilitating the condensation of acetyl-CoA with oxaloacetate, CS plays a central role in channeling metabolic intermediates towards the production of energy-rich molecules. This step not only generates citrate but also sets the stage for subsequent reactions in the TCA cycle, ultimately contributing to the efficient extraction of energy from carbohydrates and other metabolic substrates. The activity of CS is pivotal in maintaining cellular energy homeostasis and ensuring the proper functioning of aerobic metabolism. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of Citrate Synthase/CS Protein, Human (sf9, His) is 439 a.a., with molecular weight of ~46 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Citrate Synthase (CS) is a key enzyme in carbohydrate metabolism, specifically in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA to form citrate. This enzymatic process represents the first and crucial step in the TCA cycle, which is fundamental to cellular energy production. By initiating the cycle and facilitating the condensation of acetyl-CoA with oxaloacetate, CS plays a central role in channeling metabolic intermediates towards the production of energy-rich molecules. This step not only generates citrate but also sets the stage for subsequent reactions in the TCA cycle, ultimately contributing to the efficient extraction of energy from carbohydrates and other metabolic substrates. The activity of CS is pivotal in maintaining cellular energy homeostasis and ensuring the proper functioning of aerobic metabolism. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of Citrate Synthase/CS Protein, Human (sf9, His) is 439 a.a., with molecular weight of ~46 kDa.

Background

Citrate Synthase (CS) is a key enzyme in carbohydrate metabolism, specifically in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA to form citrate. This enzymatic process represents the first and crucial step in the TCA cycle, which is fundamental to cellular energy production. By initiating the cycle and facilitating the condensation of acetyl-CoA with oxaloacetate, CS plays a central role in channeling metabolic intermediates towards the production of energy-rich molecules. This step not only generates citrate but also sets the stage for subsequent reactions in the TCA cycle, ultimately contributing to the efficient extraction of energy from carbohydrates and other metabolic substrates. The activity of CS is pivotal in maintaining cellular energy homeostasis and ensuring the proper functioning of aerobic metabolism.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

O75390 (A28-G466)

Gene ID
Molecular Construction
N-term
CS (A28-G466)
Accession # O75390
His
C-term
Synonyms
Citrate synthase, mitochondrial; Citrate (Si)-synthase; CS
AA Sequence

ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

Molecular Weight

Approximately 46 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 7.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Citrate Synthase/CS Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Citrate Synthase/CS Protein, Human (sf9, His)
Cat. No.:
HY-P74251
Quantity:
MCE Japan Authorized Agent: