1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. MDL-1/CLEC5A
  6. CLEC5A/MDL-1 Protein, Rat (HEK293, His)

CLEC5A/MDL-1 Protein, Rat (HEK293, His)

Cat. No.: HY-P76269
COA Handling Instructions

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC5A/MDL-1 Protein, Rat (HEK293, His) is 161 a.a., with molecular weight of 28-39 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $78 In-stock
50 μg $220 In-stock
100 μg $350 In-stock
500 μg $980 In-stock
1 mg $1665 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC5A/MDL-1 Protein, Rat (HEK293, His) is 161 a.a., with molecular weight of 28-39 KDa.

Background

CLEC5A/MDL-1 functions as a positive regulator of osteoclastogenesis and serves as a cell surface receptor that signals through TYROBP, thereby modulating inflammatory responses. In the context of microbial infection, particularly as a critical macrophage receptor for dengue virus serotypes 1-4, CLEC5A plays a crucial role. The interaction between dengue virus and CLEC5A leads to signaling events involving the phosphorylation of TYROBP, which, interestingly, does not facilitate viral entry but rather induces the release of pro-inflammatory cytokines.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse Galectin-9 Protein is immobilized at 0.5 µg/mL (100 µL/well) can bind Recombinant Rat CLEC5A. The ED50 for this effect is 12.26 ng/mL.

Species

Rat

Source

HEK293

Tag

N-His

Accession

D3ZPN6 (V30-K190)

Gene ID
Molecular Construction
N-term
His
CLEC5A (V30-K190)
Accession # D3ZPN6
C-term
Synonyms
C-type lectin domain family 5 member A; MDL-1; CLECSF5
AA Sequence

VFGKSSDGFIPTESYGTTNVQNVSQIFGRSDESFVPTRSSGTACPNNWDFHQGRCFFFSTSESPWKNSRDYCATKGSTLAIVDTPKKLKFLQDRAGAENYFIGLIRQPGEKKWRWVNNSVFKGNVTNQEQNFNCVTIGLTMTFDAASCDISYRWICETTPK

Molecular Weight

Approximately 28-39 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CLEC5A/MDL-1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC5A/MDL-1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76269
Quantity:
MCE Japan Authorized Agent: