1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. CLM9/CD300g Protein, Human (HEK293, His)

The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Human (HEK293, His) is the recombinant human-derived CLM9/CD300g protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Human (HEK293, His) is the recombinant human-derived CLM9/CD300g protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CLM9/CD300g protein, known as a receptor, is thought to be involved in mediating lymphocyte rolling that is dependent on L-selectin. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), suggesting its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. The presence of CLM9/CD300g protein implies its significance in cellular adhesion and migration, particularly in the context of lymphocyte function. Further research is necessary to fully understand the precise mechanisms and functions of this protein, but its involvement in lymphocyte rolling and interaction underscores its potential importance in immune responses and lymphocyte-mediated processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q6UXG3-1 (L19-R247)

Gene ID
Molecular Construction
N-term
CD300LG (L19-R247)
Accession # Q6UXG3-1
6*His
C-term
Synonyms
rHuCMRF35-like molecule 9/Clm-9, His; CMRF35-Like Molecule 9; CLM-9; CD300 Antigen-Like Family Member G; Triggering Receptor Expressed on Myeloid Cells 4; TREM-4; CD300g; CD300LG; CLM9; TREM4
AA Sequence

LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVR

Molecular Weight

Approximately 64.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLM9/CD300g Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLM9/CD300g Protein, Human (HEK293, His)
Cat. No.:
HY-P70080
Quantity:
MCE Japan Authorized Agent: