1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Clumping factor A Protein, S. aureus

Clumping factor A Protein, S. aureus

Cat. No.: HY-P71581
SDS COA Handling Instructions

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Background

Clumping factor A (ClfA) protein is a cell surface-associated protein that plays a significant role in bacterial virulence. This protein is implicated in the pathogenicity of bacteria by promoting bacterial attachment exclusively to the gamma-chain of human fibrinogen. By selectively binding to the gamma-chain, ClfA facilitates the adherence of bacteria to host tissues, a crucial step in the establishment of infections. Additionally, ClfA induces the formation of bacterial clumps, which may enhance bacterial survival and evasion of the host immune response. Serval researches indicatethat ClfA is a cell surface-associated protein implicated in virulence, specifically highlighting its role in promoting bacterial attachment to the gamma-chain of human fibrinogen and inducing the formation of bacterial clumps.

Species

Staphylococcus aureus

Source

E. coli

Tag

Tag Free

Accession

Q6GB45 (G228-E558)

Gene ID

/

Molecular Construction
N-term
Clumping factor A (G228-E558)
Accession # Q6GB45
C-term
Synonyms
clfA; SAS0752; Clumping factor A; Fibrinogen receptor A; Fibrinogen-binding protein A
AA Sequence

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Clumping factor A Protein, S. aureus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Clumping factor A Protein, S. aureus
Cat. No.:
HY-P71581
Quantity:
MCE Japan Authorized Agent: