CNPY3/PRAT4A Protein, Human (HEK293, Fc)

CNPY3/PRAT4A is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for correct TLR folding (except TLR3). It ensures controlled TLR exit from the endoplasmic reticulum, affecting innate and adaptive immune responses. CNPY3/PRAT4A Protein, Human (HEK293, Fc) is the recombinant human-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CNPY3/PRAT4A Protein, Human (HEK293, Fc) is 244 a.a., with molecular weight of 60-70 kDa.

The CNPY3/PRAT4A protein acts as a Toll-like receptor (TLR)-specific co-chaperone for HSP90B1, playing a crucial role in the proper folding of TLRs, with the exception of TLR3. This function is essential for the controlled exit of TLRs from the endoplasmic reticulum, thereby influencing both innate and adaptive immune responses. CNPY3/PRAT4A interacts with HSP90B1, and this interaction is disrupted in the presence of ATP. Furthermore, it interacts with multiple TLRs, including TLR1, TLR2, TLR4, and TLR9, with the strongest interaction observed with TLR4. These interactions highlight the intricate regulatory role of CNPY3/PRAT4A in TLR folding and function, shedding light on its importance in the orchestration of immune responses.

Human

HEK293

C-hFc

Q9BT09-1 (G31-P274)

10695  [NCBI]

GPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSP

Approximately 60-70 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.