1. Recombinant Proteins
  2. Others
  3. CNPY3/PRAT4A Protein, Human (HEK293, Fc)

CNPY3/PRAT4A is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for correct TLR folding (except TLR3). It ensures controlled TLR exit from the endoplasmic reticulum, affecting innate and adaptive immune responses. CNPY3/PRAT4A Protein, Human (HEK293, Fc) is the recombinant human-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CNPY3/PRAT4A Protein, Human (HEK293, Fc) is 244 a.a., with molecular weight of 60-70 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CNPY3/PRAT4A is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for correct TLR folding (except TLR3). It ensures controlled TLR exit from the endoplasmic reticulum, affecting innate and adaptive immune responses. CNPY3/PRAT4A Protein, Human (HEK293, Fc) is the recombinant human-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CNPY3/PRAT4A Protein, Human (HEK293, Fc) is 244 a.a., with molecular weight of 60-70 kDa.

Background

The CNPY3/PRAT4A protein acts as a Toll-like receptor (TLR)-specific co-chaperone for HSP90B1, playing a crucial role in the proper folding of TLRs, with the exception of TLR3. This function is essential for the controlled exit of TLRs from the endoplasmic reticulum, thereby influencing both innate and adaptive immune responses. CNPY3/PRAT4A interacts with HSP90B1, and this interaction is disrupted in the presence of ATP. Furthermore, it interacts with multiple TLRs, including TLR1, TLR2, TLR4, and TLR9, with the strongest interaction observed with TLR4. These interactions highlight the intricate regulatory role of CNPY3/PRAT4A in TLR folding and function, shedding light on its importance in the orchestration of immune responses.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9BT09-1 (G31-P274)

Gene ID
Molecular Construction
N-term
CNPY3 (M1-P274)
Accession # Q9BT09
hFc
C-term
Synonyms
Protein canopy homolog 3; CNPY3; CTG4A; ERDA5; PRAT4A; TNRC5
AA Sequence

GPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSP

Molecular Weight

Approximately 60-70 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CNPY3/PRAT4A Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNPY3/PRAT4A Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75680
Quantity:
MCE Japan Authorized Agent: