1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Coagulation factor XIII B/F13B Protein, Human (HEK293, His)

Coagulation factor XIII B/F13B Protein, Human (HEK293, His)

Cat. No.: HY-P74238
Handling Instructions Technical Support

Coagulation factor XIII B/F13B Proteinas, the B chain of factor XIII, lacks catalytic activity but stabilizes A subunits and regulates thrombin-initiated transglutaminase formation. Functioning as a tetramer with two A chains (F13A1) and two B chains (F13B), it structurally supports the factor XIII complex, emphasizing its regulatory role in blood coagulation, particularly in transglutaminase activation by thrombin. Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is the recombinant human-derived Coagulation factor XIII B/F13B protein, expressed by HEK293 , with C-His labeled tag. The total length of Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is 641 a.a., with molecular weight of 80-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Coagulation factor XIII B/F13B Proteinas, the B chain of factor XIII, lacks catalytic activity but stabilizes A subunits and regulates thrombin-initiated transglutaminase formation. Functioning as a tetramer with two A chains (F13A1) and two B chains (F13B), it structurally supports the factor XIII complex, emphasizing its regulatory role in blood coagulation, particularly in transglutaminase activation by thrombin. Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is the recombinant human-derived Coagulation factor XIII B/F13B protein, expressed by HEK293 , with C-His labeled tag. The total length of Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is 641 a.a., with molecular weight of 80-90 kDa.

Background

The Coagulation factor XIII B/F13B protein, as the B chain of factor XIII, lacks catalytic activity but is believed to play a crucial role in stabilizing the A subunits and regulating the rate of transglutaminase formation initiated by thrombin. The protein functions as a tetramer composed of two A chains (F13A1) and two B chains (F13B), highlighting its structural significance in the formation and stability of the factor XIII complex. This intricate arrangement underscores the regulatory role of Coagulation factor XIII B/F13B in the enzymatic processes involved in blood coagulation, particularly in the context of transglutaminase activation by thrombin.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

P05160 (E21-T661)

Gene ID
Molecular Construction
N-term
F13B (E21-T661)
Accession # P05160
His
C-term
Synonyms
Coagulation factor XIII B chain; F13B
AA Sequence

EEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSSVEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLRT

Molecular Weight

Approximately 80-90 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Coagulation factor XIII B/F13B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Coagulation factor XIII B/F13B Protein, Human (HEK293, His)
Cat. No.:
HY-P74238
Quantity:
MCE Japan Authorized Agent: