Collagen alpha-1(XVIII) chain/COL18A1 Protein, Mouse (HEK293, His)

The COL18A1 protein may play a key role in shaping retinal structure and promoting neural tube closure. Its involvement extends to the regulation of extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells. Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1(XVIII) chain/COL18A1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is 184 a.a., with molecular weight of ~18.0 kDa.

The COL18A1 protein likely plays a pivotal role in shaping the retinal structure and contributing to the closure of the neural tube. Its involvement extends to the potential regulation of extracellular matrix-dependent motility and morphogenesis in both endothelial and non-endothelial cells. For these functions, homotrimerization of COL18A1 is essential, and the processes are implicated in MAPK signaling pathways. The multifaceted roles of COL18A1 suggest its significance in orchestrating cellular dynamics and tissue development, particularly in the intricate processes of retinal formation and neural tube closure.

Mouse

HEK293

C-6*His

P39061 (H1591-K1774)

12822  [NCBI]

HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.