CRABP2 Protein, Human (His)

CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag. The total length of CRABP2 Protein, Human (His) is 137 a.a., with molecular weight of ~16 kDa.

CRABP2 (Cellular Retinoic Acid-Binding Protein 2) plays a pivotal role in cellular processes by facilitating the transportation of retinoic acid to the nucleus, where it regulates the access of retinoic acid to nuclear retinoic acid receptors. Through interactions with RXR (Retinoid X Receptor) and RARA (Retinoic Acid Receptor Alpha), CRABP2 contributes to the modulation of retinoic acid signaling pathways. Additionally, CRABP2 engages with importin alpha, indicating its involvement in the intricate mechanisms of nuclear transport, further highlighting its significance in mediating retinoic acid-related cellular responses.

Human

E. coli

N-6*His

P29373 (P2-E138)

1382  [NCBI]

PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Approximately 16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.