CRACC/SLAMF7 Protein, Rhesus Macaque (HEK293, His)

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CRACC/SLAMF7 Protein, Rhesus Macaque (HEK293, His) is 204 a.a., with molecular weight of 30-50 kDa.

The CRACC/SLAMF7 protein functions as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family. Through homo- or heterotypic cell-cell interactions, SLAM receptors modulate the activation and differentiation of a diverse array of immune cells, playing a crucial role in the regulation and coordination of both innate and adaptive immune responses. The activities of CRACC/SLAMF7 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP, and/or SH2D1B/EAT-2. The protein mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway and positively regulates NK cell functions in a mechanism dependent on the adapter SH2D1B. Additionally, homotypic interactions between NK cells may contribute to activation, but in the absence of SH2D1B, CRACC/SLAMF7 inhibits NK cell function. It also exerts inhibitory effects in T-cells and may play a role in lymphocyte adhesion. In LPS-activated monocytes, CRACC/SLAMF7 negatively regulates the production of pro-inflammatory cytokines. The protein further interacts with various signaling molecules, including SH2D1B, PTPN6/SHP-1, PTPN11/SHP-2, INPP5D/SHIP1, CSK, and FYN, highlighting its involvement in diverse cellular processes and molecular interactions.

Rhesus Macaque

HEK293

C-6*His

XP_005541294.1 (S23-M226)

102133710  [NCBI]

SGSVKELVGSIGGAVTFPLKSEVKQVDSIVWTFNTTTLVTIQPEGGPMIVTQNRNKERVHFPDGGYSLKLSKLKKNDSGIYNVEIYSSSLQDPFTRKYVLRVYEHLSKPKVTMGLQSNKNGTCVTNLTCHMEHGEEDVIYTWKALGQAVNESHNGSILPISWRWGESDMTFICTVRNPVSSNSSSPILARKLCEGAADDSDSSM

30-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.