Creatine kinase M-type/CKM Protein, Human (HEK293, His)

KCRM is a cytoplasmic creatine kinase isoenzyme responsible for participating in energy transduction and maintaining energy homeostasis. KCRM reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate) and is an important serum marker of myocardial infarction. Creatine kinase M-type/CKM Protein, Human (HEK293, His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Creatine kinase M-type/CKM Protein, Human (HEK293, His) is 381 a.a., with molecular weight of ~46.0 kDa.

KCRM is a cytoplasmic creatine kinase isoenzyme that reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate). KCRM is involved in energy transduction and energy homeostasis in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm, and is an important serum marker of myocardial infarction. KCRM acts as a homodimer in striated muscle and other tissues and as a heterodimer in the heart with similar brain isozymes. Skeletal muscle, as an important secretory organ, differentially secretes cleaved KCRM peptide in type 2 diabetes mellitus (T2DM) skeletal muscle tissue. Naturally occurring mutations in KCRM may render individuals with active serum creatine kinase unresponsive to Tenofovir (HY-13910) pre-exposure prophylaxis (PrEP) HIV.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

AAP35439.1 (M1-K381)

1158  [NCBI]

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Approximately 46.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl,150 mM NaCl, 10% Glycerol, pH7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.