CTACK/CCL27 Protein, Mouse

CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free. The total length of CTACK/CCL27 Protein, Mouse is 95 a.a., with molecular weight of ~11 kDa.

CTACK/CCL27 protein serves a vital role by enabling chemokine activity and participating in cell chemotaxis. It acts upstream of positive regulation of T cell chemotaxis and positive regulation of actin cytoskeleton reorganization, suggesting its involvement in immune responses and cellular motility. This protein is located in the extracellular region and nucleus, highlighting its versatility in cellular processes. With a broad expression pattern across various tissues, including the genitourinary system, hip, liver, sensory organ, and skeleton, CTACK/CCL27 exhibits a widespread impact on different physiological contexts. The orthologous relationship with human CCL27 emphasizes the evolutionary conservation and functional relevance of this chemokine protein across species.

Measured by its ability to chemoattract HUT78 cells. The ED₅₀ for this effect is 0.0145 μg/mL, corresponding to a specific activity is 6.897×10⁴ U/mg.

• 
  Measured by its ability to chemoattract HUT78 cells. The ED₅₀ for this effect is 0.0145 μg/mL, corresponding to a specific activity is 6.897×10⁴ U/mg.

Mouse

E. coli

Tag Free

NP_035466 (L26-N120)

20301  [NCBI]

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 4mM HCL, pH 0.8, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.